PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi02g14400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 291aa    MW: 33354.5 Da    PI: 6.5096
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi02g14400.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.1e-152370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
  Vradi02g14400.1 23 KGLWSPDEDEKLIRYMLTNGQGCWSDIARNAGLQRCGKSCRLRWINYL 70
                     678*******************************************97 PP

2Myb_DNA-binding44.53.7e-1476120147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ +E+ l+ +++  +G++ W+ Ia++++ gRt++++k++w++ 
  Vradi02g14400.1  76 RGAFSSQEQHLIFHLHSIFGNR-WSQIAARLP-GRTDNEIKNFWNST 120
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.9071870IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-221873IPR009057Homeodomain-like
SuperFamilySSF466891.25E-2721117IPR009057Homeodomain-like
SMARTSM007175.8E-122272IPR001005SANT/Myb domain
PfamPF002494.9E-142370IPR001005SANT/Myb domain
CDDcd001674.82E-102670No hitNo description
PROSITE profilePS5129423.11171125IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2474126IPR009057Homeodomain-like
SMARTSM007173.1E-1375123IPR001005SANT/Myb domain
PfamPF002496.9E-1376120IPR001005SANT/Myb domain
CDDcd001678.33E-978121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MRKPDLMANK DRMKDIIKSK LRKGLWSPDE DEKLIRYMLT NGQGCWSDIA RNAGLQRCGK  60
SCRLRWINYL RPDLKRGAFS SQEQHLIFHL HSIFGNRWSQ IAARLPGRTD NEIKNFWNST  120
LKKRMKTNTS LNNSTDSSES KDVLSGIMPF NEHDIMNMSM DSSSSISSMQ AMVLSDQFDP  180
FSLLVNNHCD MTNVSEIFTC MEDGHQVNHG TLEENNKMLP SLESRSIESD SVPIDVKSHN  240
NHFNYDSFNN TDKIQGSKVE DLFGFSNHGQ GEFYLENLMQ DITSFPFLDF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-291212516128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014493577.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A0S3S8M80.0A0A0S3S8M8_PHAAN; Uncharacterized protein
STRINGGLYMA12G36630.11e-167(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.12e-72myb domain protein 83